PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000292.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 325aa    MW: 36088.1 Da    PI: 11.5314
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000292.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA46.26.3e-1572106135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C+ Cg+t+T +WR gp+g  t CnaCGl+ rk g+
  Do000292.1  72 CVRCGATETQQWRAGPNGAHTFCNACGLRRRKAGE 106
                 9*******************************987 PP

2GATA49.17.8e-16262296135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C +Cg+++Tp WR+gp g +tLC+aCG++y+  +l
  Do000292.1 262 CDHCGSSSTPKWRKGPKGRRTLCKACGVRYKEGRL 296
                 9******************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.8E-966120IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.88666105IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.6E-1368106IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.0E-1168108No hitNo description
CDDcd002026.23E-971118No hitNo description
PfamPF003203.4E-1272106IPR000679Zinc finger, GATA-type
SMARTSM004013.5E-9256310IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.334256292IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.33E-11258318No hitNo description
Gene3DG3DSA:3.30.50.104.1E-13260294IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.25E-10261312No hitNo description
PfamPF003201.8E-13262296IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MVGRGGAERE REGRLPGVPA WAKRLDIAWW EASVTRKGRS HLGPVKPSGW WAFRRPVPPP  60
PAARLATRPR ECVRCGATET QQWRAGPNGA HTFCNACGLR RRKAGERWGK RRGPRRARVS  120
HQPPPPLESR PVPESPPDRR PIRDSPDVFL ERRTSPKRVK SPPPGTDSES ESEQLSPPET  180
PASESSPPGS PIWEGPLLDG FQLARRKRKI PSPTSPPTMM GAAPPTVEAS SPATMEAAPA  240
PAVDQRRRKK KKPAKHNEEK RCDHCGSSST PKWRKGPKGR RTLCKACGVR YKEGRLLPEY  300
RPQACPTFDS AKHASSHSQV LELRR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1244251QRRRKKKK
2245251RRRKKKK
3246252RRKKKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP72732646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.12e-26GATA transcription factor 12